SCOPe 2.07: Domain d4q8bb3: 4q8b B:357-512

Lineage for d4q8bb3 (4q8b B:357-512)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (2 species)

7. Species Bacillus subtilis [TaxId:224308] [271928] (8 PDB entries)

8. Domain d4q8bb3: 4q8b B:357-512 [271940]
   automated match to d3zdwa3
   complexed with cl, cu, mg, oxy, pge, sxx

Details for d4q8bb3

PDB Entry: 4q8b, 1.91 Å

PDB Description: the crystal structure of cota laccase complexed with sinapic acid

PDB Compounds: (B:) spore coat protein a

SCOPe Domain Sequences for d4q8bb3:

Sequence, based on SEQRES records:

>d4q8bb3 b.6.1.3 (B:357-512) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdph

Sequence, based on observed residues (ATOM records):

>d4q8bb3 b.6.1.3 (B:357-512) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
sypqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihl
hlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgp
ysgryvwhchilehedydmmrpmditdph

Timeline for d4q8bb3:

• d4q8bb3 first appeared in SCOPe 2.05
  
• d4q8bb3 appears in SCOPe 2.06
  
• d4q8bb3 appears in the current release, SCOPe 2.08