Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [271635] (1 PDB entry) |
Domain d4lgma_: 4lgm A: [271636] automated match to d4lcba_ complexed with cl |
PDB Entry: 4lgm (more details), 2.71 Å
SCOPe Domain Sequences for d4lgma_:
Sequence, based on SEQRES records: (download)
>d4lgma_ c.37.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} kvsfkdivglddvkealreaiiyptkrpdlfplgwprgillygppgcgktmiaaavanei dsifmqldaasvmskwlgeaeknvanvfkmareeskkqnkpaiifidqldallgvystev ggearvrnqflkemdglldksenykvyvigatnkpwrldeaflrrfqkriyvplpdyeqr lslfkyytskikldtevsleelakltegytasdirdivqaahikvvkemfknnlgeprti tlqdfkdilkvrmpsvnpelikayeawtekf
>d4lgma_ c.37.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} kvsfkdivglddvkealreaiiyptkrpdlfplgwprgillygppgcgktmiaaavanei dsifmqldaasvmsgeaeknvanvfkmareeskkqnkpaiifidqldallarvrnqflke mdgllvyvigatnkpwrldeaflrrfqkriyvplpdyeqrlslfkyytskikldtevsle elakltegytasdirdivqaahikvvkemfknnlgeprtitlqdfkdilkvrmpsvnpel ikayeawtekf
Timeline for d4lgma_: