Lineage for d4lgma_ (4lgm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114743Species Sulfolobus solfataricus [TaxId:273057] [271635] (1 PDB entry)
  8. 2114744Domain d4lgma_: 4lgm A: [271636]
    automated match to d4lcba_
    complexed with cl

Details for d4lgma_

PDB Entry: 4lgm (more details), 2.71 Å

PDB Description: crystal structure of sulfolobus solfataricus vps4
PDB Compounds: (A:) Vps4 AAA ATPase

SCOPe Domain Sequences for d4lgma_:

Sequence, based on SEQRES records: (download)

>d4lgma_ c.37.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
kvsfkdivglddvkealreaiiyptkrpdlfplgwprgillygppgcgktmiaaavanei
dsifmqldaasvmskwlgeaeknvanvfkmareeskkqnkpaiifidqldallgvystev
ggearvrnqflkemdglldksenykvyvigatnkpwrldeaflrrfqkriyvplpdyeqr
lslfkyytskikldtevsleelakltegytasdirdivqaahikvvkemfknnlgeprti
tlqdfkdilkvrmpsvnpelikayeawtekf

Sequence, based on observed residues (ATOM records): (download)

>d4lgma_ c.37.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
kvsfkdivglddvkealreaiiyptkrpdlfplgwprgillygppgcgktmiaaavanei
dsifmqldaasvmsgeaeknvanvfkmareeskkqnkpaiifidqldallarvrnqflke
mdgllvyvigatnkpwrldeaflrrfqkriyvplpdyeqrlslfkyytskikldtevsle
elakltegytasdirdivqaahikvvkemfknnlgeprtitlqdfkdilkvrmpsvnpel
ikayeawtekf

SCOPe Domain Coordinates for d4lgma_:

Click to download the PDB-style file with coordinates for d4lgma_.
(The format of our PDB-style files is described here.)

Timeline for d4lgma_: