Lineage for d4cvka2 (4cvk A:101-319)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. Protein automated matches [254749] (4 species)
    not a true protein
  7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries)
  8. Domain d4cvka2: 4cvk A:101-319 [271627]
    Other proteins in same PDB: d4cvka1, d4cvka3
    automated match to d1gg4a4
    complexed with ala, api, fga, mub, udp

Details for d4cvka2

PDB Entry: 4cvk (more details), 1.92 Å

PDB Description: pamurf in complex with udp-murnac-tripeptide (mdap)
PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase

SCOPe Domain Sequences for d4cvka2:

Sequence, based on SEQRES records: (download)

>d4cvka2 c.72.2.0 (A:101-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tgplaamtgssgkttvkemlasilrtqagdaesvlatrgnlnndlgvpltllqlapqhrs
avielgasrigeiaytveltrphvaiitnagtahvgefggpekiveakgeileglaadgt
avlnlddkafdtwkarasgrplltfsldrpqadfraadlqrdargcmgfrlqgvageaqv
qlnllgrhnvanalaaaaaahalgvpldgivaglqalqp

Sequence, based on observed residues (ATOM records): (download)

>d4cvka2 c.72.2.0 (A:101-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tgplaamtgssgkttvkemlasilrtqagdaesvlatrgnlnndlgvpltllqlapqhrs
avielgasrigeiaytveltrphvaiitnafggpekiveakgeileglaadgtavlnldd
kafdtwkarasgrplltfsldrpqadfraadlqrdargcmgfrlqgvageaqvqlnllgr
hnvanalaaaaaahalgvpldgivaglqalqp

SCOPe Domain Coordinates for d4cvka2 are not available.

Timeline for d4cvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cvka1, d4cvka3