Lineage for d4yeta1 (4yet A:2-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980109Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980386Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1980387Protein automated matches [226859] (32 species)
    not a true protein
  7. 1980416Species Babesia bovis [TaxId:5865] [226662] (1 PDB entry)
  8. 1980417Domain d4yeta1: 4yet A:2-83 [271597]
    Other proteins in same PDB: d4yeta2, d4yetb2, d4yetb3
    automated match to d4k2wa1
    complexed with fe

Details for d4yeta1

PDB Entry: 4yet (more details), 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur sad
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yeta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeta1 a.2.11.0 (A:2-83) automated matches {Babesia bovis [TaxId: 5865]}
afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt
gavfnnaaqiwnhtfywnsmgp

SCOPe Domain Coordinates for d4yeta1:

Click to download the PDB-style file with coordinates for d4yeta1.
(The format of our PDB-style files is described here.)

Timeline for d4yeta1: