![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (31 species) not a true protein |
![]() | Species Babesia bovis [TaxId:5865] [226662] (2 PDB entries) |
![]() | Domain d4yeta1: 4yet A:2-83 [271597] Other proteins in same PDB: d4yeta2, d4yetb2 automated match to d4k2wa1 complexed with fe |
PDB Entry: 4yet (more details), 1.75 Å
SCOPe Domain Sequences for d4yeta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yeta1 a.2.11.0 (A:2-83) automated matches {Babesia bovis [TaxId: 5865]} afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt gavfnnaaqiwnhtfywnsmgp
Timeline for d4yeta1: