SCOPe 2.06: Domain d4y65b_: 4y65 B:

Lineage for d4y65b_ (4y65 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein automated matches [191031] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271586] (1 PDB entry)

8. Domain d4y65b_: 4y65 B: [271588]
   automated match to d3opkc_
   mutant

Details for d4y65b_

PDB Entry: 4y65, 1.7 Å

PDB Description: crystal structure of e.coli cuta1 c16a/c39a/c79a mutation

PDB Compounds: (B:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4y65b_:

Sequence; same for both SEQRES and ATOM records:

>d4y65b_ d.58.5.2 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ekssntasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyevq
milkttvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr

Timeline for d4y65b_:

• d4y65b_ first appeared in SCOPe 2.05
  
• d4y65b_ appears in SCOPe 2.07
  
• d4y65b_ appears in the current release, SCOPe 2.08