Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein automated matches [191031] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [271586] (1 PDB entry) |
Domain d4y65b_: 4y65 B: [271588] automated match to d3opkc_ mutant |
PDB Entry: 4y65 (more details), 1.7 Å
SCOPe Domain Sequences for d4y65b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y65b_ d.58.5.2 (B:) automated matches {Escherichia coli [TaxId: 83333]} ekssntasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyevq milkttvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr
Timeline for d4y65b_: