Lineage for d4y65b_ (4y65 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950826Protein automated matches [191031] (3 species)
    not a true protein
  7. 2950827Species Escherichia coli [TaxId:83333] [271586] (1 PDB entry)
  8. 2950829Domain d4y65b_: 4y65 B: [271588]
    automated match to d3opkc_
    mutant

Details for d4y65b_

PDB Entry: 4y65 (more details), 1.7 Å

PDB Description: crystal structure of e.coli cuta1 c16a/c39a/c79a mutation
PDB Compounds: (B:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4y65b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y65b_ d.58.5.2 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ekssntasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyevq
milkttvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d4y65b_:

Click to download the PDB-style file with coordinates for d4y65b_.
(The format of our PDB-style files is described here.)

Timeline for d4y65b_: