SCOPe 2.05: Domain d4xxla_: 4xxl A:

Lineage for d4xxla_ (4xxl A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (18 species)
   not a true protein

7. Species Sideroxydans lithotrophicus [TaxId:580332] [271583] (1 PDB entry)

8. Domain d4xxla_: 4xxl A: [271584]
   automated match to d4jcga_
   complexed with hem

Details for d4xxla_

PDB Entry: 4xxl, 1.47 Å

PDB Description: crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1

PDB Compounds: (A:) Cytochrome c class I

SCOPe Domain Sequences for d4xxla_:

Sequence; same for both SEQRES and ATOM records:

>d4xxla_ a.3.1.0 (A:) automated matches {Sideroxydans lithotrophicus [TaxId: 580332]}
avdvdaakslarenncfkchgvdkekdgpsykkvaekyrgkadaeaklihhvtsgekakf
pdgheeehkningkaspeaiknlvdwilslws

Timeline for d4xxla_:

• d4xxla_ is new in SCOPe 2.05-stable
  
• d4xxla_ is called d4xxla1 in SCOPe 2.06
  
• d4xxla_ appears in the current release, SCOPe 2.08, called d4xxla1