Lineage for d4xxla1 (4xxl A:28-117)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691750Species Sideroxydans lithotrophicus [TaxId:580332] [271583] (1 PDB entry)
  8. 2691751Domain d4xxla1: 4xxl A:28-117 [271584]
    Other proteins in same PDB: d4xxla2
    automated match to d4jcga_
    complexed with hec

Details for d4xxla1

PDB Entry: 4xxl (more details), 1.47 Å

PDB Description: crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1
PDB Compounds: (A:) Cytochrome c class I

SCOPe Domain Sequences for d4xxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxla1 a.3.1.0 (A:28-117) automated matches {Sideroxydans lithotrophicus [TaxId: 580332]}
avdvdaakslarenncfkchgvdkekdgpsykkvaekyrgkadaeaklihhvtsgekakf
pdgheeehkningkaspeaiknlvdwilsl

SCOPe Domain Coordinates for d4xxla1:

Click to download the PDB-style file with coordinates for d4xxla1.
(The format of our PDB-style files is described here.)

Timeline for d4xxla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xxla2