SCOPe 2.08: Domain d4xxla1: 4xxl A:28-117

Lineage for d4xxla1 (4xxl A:28-117)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Sideroxydans lithotrophicus [TaxId:580332] [271583] (1 PDB entry)

8. Domain d4xxla1: 4xxl A:28-117 [271584]
   Other proteins in same PDB: d4xxla2
   automated match to d4jcga_
   complexed with hec

Details for d4xxla1

PDB Entry: 4xxl, 1.47 Å

PDB Description: crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1

PDB Compounds: (A:) Cytochrome c class I

SCOPe Domain Sequences for d4xxla1:

Sequence; same for both SEQRES and ATOM records:

>d4xxla1 a.3.1.0 (A:28-117) automated matches {Sideroxydans lithotrophicus [TaxId: 580332]}
avdvdaakslarenncfkchgvdkekdgpsykkvaekyrgkadaeaklihhvtsgekakf
pdgheeehkningkaspeaiknlvdwilsl

Timeline for d4xxla1:

• d4xxla1 first appeared in SCOPe 2.05, called d4xxla_
  
• d4xxla1 appears in SCOPe 2.07