SCOPe 2.07: Domain d4pljl2: 4plj L:108-212

Lineage for d4pljl2 (4plj L:108-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4pljl2: 4plj L:108-212 [271461]
   Other proteins in same PDB: d4pljc1, d4pljl1
   automated match to d2fd6l2

Details for d4pljl2

PDB Entry: 4plj, 2.3 Å

PDB Description: hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12

PDB Compounds: (L:) 8G12 light chain

SCOPe Domain Sequences for d4pljl2:

Sequence; same for both SEQRES and ATOM records:

>d4pljl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppssekvlsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4pljl2:

• d4pljl2 first appeared in SCOPe 2.05
  
• d4pljl2 appears in SCOPe 2.06
  
• d4pljl2 appears in the current release, SCOPe 2.08