Lineage for d4qizb_ (4qiz B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2422112Protein automated matches [190681] (2 species)
    not a true protein
  7. 2422122Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)
  8. 2422171Domain d4qizb_: 4qiz B: [271441]
    automated match to d3d0na_
    complexed with edo, wwx, zn

Details for d4qizb_

PDB Entry: 4qiz (more details), 1.55 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with inhibitor
PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4qizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qizb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d4qizb_:

Click to download the PDB-style file with coordinates for d4qizb_.
(The format of our PDB-style files is described here.)

Timeline for d4qizb_: