SCOPe 2.07: Domain d4qiza_: 4qiz A:

Lineage for d4qiza_ (4qiz A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)

8. Domain d4qiza_: 4qiz A: [271440]
   automated match to d3d0na_
   complexed with edo, wwx, zn

Details for d4qiza_

PDB Entry: 4qiz, 1.55 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with inhibitor

PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4qiza_:

Sequence; same for both SEQRES and ATOM records:

>d4qiza_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d4qiza_:

• d4qiza_ first appeared in SCOPe 2.05
  
• d4qiza_ appears in SCOPe 2.06
  
• d4qiza_ appears in the current release, SCOPe 2.08