SCOPe 2.08: Domain d1epba_: 1epb A:

Lineage for d1epba_ (1epb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Retinoic acid-binding protein [50830] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50831] (2 PDB entries)

8. Domain d1epba_: 1epb A: [27126]
   complexed with 9cr

Details for d1epba_

PDB Entry: 1epb

PDB Description: structure of the epididymal retinoic acid-binding protein at 2.1 angstroms resolution

PDB Compounds: (A:) epididymal retinoic acid-binding protein

SCOPe Domain Sequences for d1epba_:

Sequence; same for both SEQRES and ATOM records:

>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkdfdiskflgfwyeiafaskmgtpglahkeekmgamvvelkenllaltttyysedhcvl
ekvtategdgpakfqvtrlsgkkevvveatdyltyaiiditslvagavhrtmklysrsld
dngealynfrkitsdhgfsetdlyilkhdltcvkvlqsaa

Timeline for d1epba_:

• d1epba_ first appeared (with stable ids) in SCOP 1.55
  
• d1epba_ appears in SCOPe 2.07