Lineage for d1exsa_ (1exs A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1551712Protein beta-Lactoglobulin [50827] (3 species)
  7. 1551763Species Pig (Sus scrofa) [TaxId:9823] [50829] (1 PDB entry)
  8. 1551764Domain d1exsa_: 1exs A: [27125]
    CASP4
    complexed with gol, na

Details for d1exsa_

PDB Entry: 1exs (more details), 2.39 Å

PDB Description: structure of porcine beta-lactoglobulin
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1exsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]}
vevtpimteldtqkvagtwhtvamavsdvslldakssplkayveglkptpegdleillqk
rendkcaqevllakktdipavfkinaldenqlflldtdydshlllcmensaspehslvcq
slartlevddqirekfedalktlsvpmrilpaqleeqcrv

SCOPe Domain Coordinates for d1exsa_:

Click to download the PDB-style file with coordinates for d1exsa_.
(The format of our PDB-style files is described here.)

Timeline for d1exsa_: