PDB entry 1exs

View 1exs on RCSB PDB site
Description: structure of porcine beta-lactoglobulin
Class: lipid-binding protein
Keywords: lipocalin fold, LIPID-BINDING PROTEIN
Deposited on 2000-05-04, released 2000-11-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1exsa_
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1exsA (A:)
vevtpimteldtqkvagtwhtvamavsdvslldakssplkayveglkptpegdleillqk
rendkcaqevllakktdipavfkinaldenqlflldtdydshlllcmensaspehslvcq
slartlevddqirekfedalktlsvpmrilpaqleeqcrv