Lineage for d4ys8a_ (4ys8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899323Species Burkholderia thailandensis [TaxId:271848] [271140] (2 PDB entries)
  8. 2899328Domain d4ys8a_: 4ys8 A: [271144]
    Other proteins in same PDB: d4ys8b2, d4ys8c2, d4ys8d2
    automated match to d2xwna_
    complexed with act, gol

Details for d4ys8a_

PDB Entry: 4ys8 (more details), 2.45 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4ys8a_:

Sequence, based on SEQRES records: (download)

>d4ys8a_ c.68.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcagtgsrsgsalpkqyrtlagrallhytlaafdacsefaqtlvvispddah
fdarrfaglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirt
ligalkddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiq
raqlegrdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailah

Sequence, based on observed residues (ATOM records): (download)

>d4ys8a_ c.68.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcaggsalpkqyrtlagrallhytlaafdacsefaqtlvvispddahfdarr
faglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirtligal
kddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiqraqle
grdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeailah

SCOPe Domain Coordinates for d4ys8a_:

Click to download the PDB-style file with coordinates for d4ys8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ys8a_: