SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ys8b1 (4ys8 B:2-230)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (24 species)
    not a true protein
  7. 2133973Species Burkholderia thailandensis [TaxId:271848] [271140] (2 PDB entries)
  8. 2133979Domain d4ys8b1: 4ys8 B:2-230 [271142]
    Other proteins in same PDB: d4ys8b2, d4ys8c2, d4ys8d2
    automated match to d2xwna_
    complexed with act, gol

Details for d4ys8b1

PDB Entry: 4ys8 (more details), 2.45 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4ys8b1:

Sequence, based on SEQRES records: (download)

>d4ys8b1 c.68.1.0 (B:2-230) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcagtgsrsgsalpkqyrtlagrallhytlaafdacsefaqtlvvispddah
fdarrfaglrfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirt
ligalkddpvggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiq
raqlegrdltdeasaiewaghtprvvqgslrnfkvtypedfdlaeaila

Sequence, based on observed residues (ATOM records): (download)

>d4ys8b1 c.68.1.0 (B:2-230) automated matches {Burkholderia thailandensis [TaxId: 271848]}
tsrlfalipcalpkqyrtlagrallhytlaafdacsefaqtlvvispddahfdarrfagl
rfavrrcggasrqasvmngliqlaefgatdadwvlvhdaarpgitpalirtligalkddp
vggivalpvadtlkrvpaggdaiertesrnglwqaqtpqmfrigmlrdaiqraqlegrdl
tdeasaiewaghtprvvqgslrnfkvtypedfdlaeaila

SCOPe Domain Coordinates for d4ys8b1:

Click to download the PDB-style file with coordinates for d4ys8b1.
(The format of our PDB-style files is described here.)

Timeline for d4ys8b1:

  • d4ys8b1 first appeared in SCOPe 2.05, called d4ys8b_