Lineage for d1rlbe_ (1rlb E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169857Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 169858Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 169859Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
  6. 169998Protein Retinol binding protein [50816] (5 species)
  7. 169999Species Chicken (Gallus gallus) [TaxId:9031] [50820] (1 PDB entry)
  8. 170000Domain d1rlbe_: 1rlb E: [27090]
    Other proteins in same PDB: d1rlba_, d1rlbb_, d1rlbc_, d1rlbd_

Details for d1rlbe_

PDB Entry: 1rlb (more details), 3.1 Å

PDB Description: retinol binding protein complexed with transthyretin

SCOP Domain Sequences for d1rlbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlbe_ b.60.1.1 (E:) Retinol binding protein {Chicken (Gallus gallus)}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc

SCOP Domain Coordinates for d1rlbe_:

Click to download the PDB-style file with coordinates for d1rlbe_.
(The format of our PDB-style files is described here.)

Timeline for d1rlbe_: