Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Retinol binding protein [50816] (5 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50820] (1 PDB entry) |
Domain d1rlbe_: 1rlb E: [27090] Other proteins in same PDB: d1rlba_, d1rlbb_, d1rlbc_, d1rlbd_ complexed with rea |
PDB Entry: 1rlb (more details), 3.1 Å
SCOPe Domain Sequences for d1rlbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlbe_ b.60.1.1 (E:) Retinol binding protein {Chicken (Gallus gallus) [TaxId: 9031]} erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc
Timeline for d1rlbe_: