SCOPe 2.06: Domain d4ue2b_: 4ue2 B:

Lineage for d4ue2b_ (4ue2 B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)

8. Domain d4ue2b_: 4ue2 B: [270683]
   Other proteins in same PDB: d4ue2q_, d4ue2r_, d4ue2s_
   automated match to d4urhc_
   complexed with f3s, fco, gol, mg, ni, sf4

Details for d4ue2b_

PDB Entry: 4ue2, 2.02 Å

PDB Description: structure of air-treated anaerobically purified d. fructosovorans nife-hydrogenase

PDB Compounds: (B:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d4ue2b_:

Sequence; same for both SEQRES and ATOM records:

>d4ue2b_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

Timeline for d4ue2b_:

• d4ue2b_ first appeared in SCOPe 2.05
  
• d4ue2b_ appears in SCOPe 2.07
  
• d4ue2b_ appears in the current release, SCOPe 2.08