Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
Protein automated matches [226843] (9 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries) |
Domain d4u39i2: 4u39 I:215-313 [270651] Other proteins in same PDB: d4u39a1, d4u39b1, d4u39c1, d4u39d1, d4u39e1, d4u39f1, d4u39g1, d4u39h1, d4u39i1 automated match to d2vxya2 complexed with po4 |
PDB Entry: 4u39 (more details), 3.19 Å
SCOPe Domain Sequences for d4u39i2:
Sequence, based on SEQRES records: (download)
>d4u39i2 d.79.2.0 (I:215-313) automated matches {Bacillus subtilis [TaxId: 1423]} ktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggtnlslye vqeaadivasasdqdvnmifgsvinenlkdeivvtviat
>d4u39i2 d.79.2.0 (I:215-313) automated matches {Bacillus subtilis [TaxId: 1423]} ktimsnkgsalmgigiataakkaissplleaaidgaqgvlmnitlyevqeaadivasasd qdvnmifgsvinenvvtviat
Timeline for d4u39i2: