Lineage for d2vxya2 (2vxy A:209-316)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.0: automated matches [227141] (1 protein)
not a true familyProtein automated matches [226843] (9 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries) 
Domain d2vxya2: 2vxy A:209-316 [206533]
Other proteins in same PDB: d2vxya1
automated match to d1rq2a2
complexed with cit, k
Details for d2vxya2
PDB Entry: 2vxy (more details), 1.7 Å
PDB Description: the structure of ftsz from bacillus subtilis at 1.7a resolution
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d2vxya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxya2 d.79.2.0 (A:209-316) automated matches {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgfi
SCOPe Domain Coordinates for d2vxya2:
Click to download the PDB-style file with coordinates for d2vxya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vxya2:
- d2vxya2 first appeared in SCOPe 2.03
- d2vxya2 appears in SCOPe 2.07
View in 3D
