Lineage for d4tmrb_ (4tmr B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505258Species Plasmodium vivax [TaxId:126793] [261543] (24 PDB entries)
  8. 2505329Domain d4tmrb_: 4tmr B: [270447]
    automated match to d4pffa_
    complexed with 99s, cl, plg

Details for d4tmrb_

PDB Entry: 4tmr (more details), 2.7 Å

PDB Description: crystal structure of ternary complex of plasmodium vivax shmt with glycine and a novel pyrazolopyran 99s: methyl 5-{3-[(4s)-6-amino-5- cyano-3-methyl-4-(propan-2-yl)-2,4-dihydropyrano[2,3-c]pyrazol-4-yl]- 5-cyanophenyl}thiophene-2-carboxylate .
PDB Compounds: (B:) Serine hydroxymethyltransferase, putative

SCOPe Domain Sequences for d4tmrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tmrb_ c.67.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d4tmrb_:

Click to download the PDB-style file with coordinates for d4tmrb_.
(The format of our PDB-style files is described here.)

Timeline for d4tmrb_: