Lineage for d4r87h_ (4r87 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210086Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)
  8. 2210140Domain d4r87h_: 4r87 H: [270414]
    automated match to d3eg7b_
    complexed with coa, peg, spm

Details for d4r87h_

PDB Entry: 4r87 (more details), 2.61 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine
PDB Compounds: (H:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4r87h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r87h_ d.108.1.0 (H:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

SCOPe Domain Coordinates for d4r87h_:

Click to download the PDB-style file with coordinates for d4r87h_.
(The format of our PDB-style files is described here.)

Timeline for d4r87h_: