![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (48 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
![]() | Domain d4r57j_: 4r57 J: [270400] automated match to d3eg7b_ complexed with aco, peg, pg4 |
PDB Entry: 4r57 (more details), 2.08 Å
SCOPe Domain Sequences for d4r57j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r57j_ d.108.1.0 (J:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
Timeline for d4r57j_: