Lineage for d4r57g_ (4r57 G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576103Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2576141Domain d4r57g_: 4r57 G: [270401]
    automated match to d3eg7b_
    complexed with aco, peg, pg4

Details for d4r57g_

PDB Entry: 4r57 (more details), 2.08 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa
PDB Compounds: (G:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4r57g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r57g_ d.108.1.0 (G:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr

SCOPe Domain Coordinates for d4r57g_:

Click to download the PDB-style file with coordinates for d4r57g_.
(The format of our PDB-style files is described here.)

Timeline for d4r57g_: