SCOPe 2.08: Domain d4p6da_: 4p6d A:

Lineage for d4p6da_ (4p6d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein automated matches [190415] (4 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [270331] (6 PDB entries)

8. Domain d4p6da_: 4p6d A: [270336]
   automated match to d1ieza_
   complexed with edo, po4

Details for d4p6da_

PDB Entry: 4p6d, 1.59 Å

PDB Description: structure of ribb complexed with po4 ion

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d4p6da_:

Sequence, based on SEQRES records:

>d4p6da_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecs
givclclteaqadrlalppmvvnnnsanqtaftvsieakhgvttgvsaqdrvttiktaan
pqakpedlarpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsma
ktpeiiefgklhnmpvltiedmvqyriqfdlkla

Sequence, based on observed residues (ATOM records):

>d4p6da_ d.115.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirecs
givclclteaqadrlalpptvsieakhgvttgvsaqdrvttiktaanpqakpedlarpgh
vfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmaktpeiiefgklhn
mpvltiedmvqyriqfdlkla

Timeline for d4p6da_:

• d4p6da_ first appeared in SCOPe 2.05
  
• d4p6da_ appears in SCOPe 2.07