Lineage for d1ieza_ (1iez A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971984Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2971985Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2972000Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2972001Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 2972002Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 2972007Domain d1ieza_: 1iez A: [66129]

Details for d1ieza_

PDB Entry: 1iez (more details)

PDB Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1ieza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieza_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
tmarapeciefankhnmalvtiedlvayrqaherkas

SCOPe Domain Coordinates for d1ieza_:

Click to download the PDB-style file with coordinates for d1ieza_.
(The format of our PDB-style files is described here.)

Timeline for d1ieza_: