Lineage for d2mnha_ (2mnh A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021957Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
    automatically mapped to Pfam PF13505
  6. 3021968Protein Outer membrane protein X (OMPX) [56929] (1 species)
  7. 3021969Species Escherichia coli [TaxId:562] [56930] (8 PDB entries)
    Uniprot P36546
  8. 3021972Domain d2mnha_: 2mnh A: [270272]
    automated match to d1qj8a_

Details for d2mnha_

PDB Entry: 2mnh (more details)

PDB Description: refined structure of outer membrane protein x in nanodisc by measuring residual dipolar couplings
PDB Compounds: (A:) Outer membrane protein X

SCOPe Domain Sequences for d2mnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mnha_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]}
tstvtggyaqsdaqgqmnkmggfnlkyryeednsplgvigsftyteksrtassgdynknq
yygitagpayrindwasiygvvgvgygkfqtteyptykndtsdygfsygaglqfnpmenv
aldfsyeqsrirsvdvgtwiagvgyrf

SCOPe Domain Coordinates for d2mnha_:

Click to download the PDB-style file with coordinates for d2mnha_.
(The format of our PDB-style files is described here.)

Timeline for d2mnha_: