Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.1: Outer membrane protein [56926] (3 proteins) automatically mapped to Pfam PF13505 |
Protein Outer membrane protein X (OMPX) [56929] (1 species) |
Species Escherichia coli [TaxId:562] [56930] (8 PDB entries) Uniprot P36546 |
Domain d2mnha_: 2mnh A: [270272] automated match to d1qj8a_ |
PDB Entry: 2mnh (more details)
SCOPe Domain Sequences for d2mnha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mnha_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]} tstvtggyaqsdaqgqmnkmggfnlkyryeednsplgvigsftyteksrtassgdynknq yygitagpayrindwasiygvvgvgygkfqtteyptykndtsdygfsygaglqfnpmenv aldfsyeqsrirsvdvgtwiagvgyrf
Timeline for d2mnha_: