SCOPe 2.06: Domain d4mhda_: 4mhd A:

Lineage for d4mhda_ (4mhd A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)

8. Domain d4mhda_: 4mhd A: [270269]
   automated match to d3eg7b_
   complexed with spd

Details for d4mhda_

PDB Entry: 4mhd, 2.32 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine

PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4mhda_:

Sequence; same for both SEQRES and ATOM records:

>d4mhda_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr

Timeline for d4mhda_:

• d4mhda_ first appeared in SCOPe 2.05
  
• d4mhda_ appears in SCOPe 2.07
  
• d4mhda_ appears in the current release, SCOPe 2.08