SCOPe 2.08: Domain d1ytfd2: 1ytf D:55-119

Lineage for d1ytfd2 (1ytf D:55-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
   barrel, closed; n=6, S=12; mixed beta-sheet

4. Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family)
   dimer of non-identical beta-sheet domains

5. Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
   heterodimer of two homologous chains

6. Protein Small chain TOA2, C-terminal domain [88686] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries)

8. Domain d1ytfd2: 1ytf D:55-119 [27011]
   Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_, d1ytfd1
   protein/DNA complex

Details for d1ytfd2

PDB Entry: 1ytf, 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

PDB Compounds: (D:) protein (transcription factor iia - toa2 subunit)

SCOPe Domain Sequences for d1ytfd2:

Sequence, based on SEQRES records:

>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnsk

Sequence, based on observed residues (ATOM records):

>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvesvisvdklrivacnsk

Timeline for d1ytfd2:

• d1ytfd2 first appeared (with stable ids) in SCOP 1.55
  
• d1ytfd2 appears in SCOPe 2.07