SCOPe 2.08: Domain d1ytfb_: 1ytf B:

Lineage for d1ytfb_ (1ytf B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family)
   dimer of non-identical alpha-hairpins

5. Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
   heterodimer of two homologous chains

6. Protein Large chain TOA1, N-terminal domain [88833] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88834] (2 PDB entries)

8. Domain d1ytfb_: 1ytf B: [16997]
   Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfc_, d1ytfd1, d1ytfd2
   protein/DNA complex

Details for d1ytfb_

PDB Entry: 1ytf, 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

PDB Compounds: (B:) protein (transcription factor iia - toa1n subunit)

SCOPe Domain Sequences for d1ytfb_:

Sequence; same for both SEQRES and ATOM records:

>d1ytfb_ a.32.1.1 (B:) Large chain TOA1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklt

Timeline for d1ytfb_:

• d1ytfb_ first appeared (with stable ids) in SCOP 1.55, called d1ytfb1
  
• d1ytfb_ appears in SCOPe 2.07