SCOPe 2.07: Domain d4x3tb1: 4x3t B:7-64

Lineage for d4x3tb1 (4x3t B:7-64)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)

8. Domain d4x3tb1: 4x3t B:7-64 [270095]
   Other proteins in same PDB: d4x3ta2, d4x3tb2, d4x3tc2, d4x3td2, d4x3te2, d4x3tf2
   automated match to d2kvma_
   complexed with 45e, edo, zn

Details for d4x3tb1

PDB Entry: 4x3t, 2.14 Å

PDB Description: crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms37452

PDB Compounds: (B:) Chromobox protein homolog 7

SCOPe Domain Sequences for d4x3tb1:

Sequence; same for both SEQRES and ATOM records:

>d4x3tb1 b.34.13.2 (B:7-64) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
geqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd

Timeline for d4x3tb1:

• d4x3tb1 first appeared in SCOPe 2.05, called d4x3tb_
  
• d4x3tb1 appears in SCOPe 2.06
  
• d4x3tb1 appears in the current release, SCOPe 2.08