![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein automated matches [191035] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries) |
![]() | Domain d4x3tb1: 4x3t B:7-64 [270095] Other proteins in same PDB: d4x3ta2, d4x3tb2, d4x3tc2, d4x3td2, d4x3te2, d4x3tf2 automated match to d2kvma_ complexed with 45e, edo, zn |
PDB Entry: 4x3t (more details), 2.14 Å
SCOPe Domain Sequences for d4x3tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x3tb1 b.34.13.2 (B:7-64) automated matches {Mouse (Mus musculus) [TaxId: 10090]} geqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd
Timeline for d4x3tb1: