Lineage for d1egxa_ (1egx A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232087Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 232088Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 232199Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (5 proteins)
  6. 232220Protein Vasodilator-stimulated phosphoprotein (VASP) [50772] (1 species)
  7. 232221Species Human (Homo sapiens) [TaxId:9606] [50773] (1 PDB entry)
  8. 232222Domain d1egxa_: 1egx A: [27000]

Details for d1egxa_

PDB Entry: 1egx (more details)

PDB Description: solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)

SCOP Domain Sequences for d1egxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens)}
msetvicssratvmlyddgnkrwlpagtgpqafsrvqiyhnptansfrvvgrkmqpdqqv
vincaivrgvkynqatpnfhqwrdarqvwglnfgskedaaqfaagmasalealeg

SCOP Domain Coordinates for d1egxa_:

Click to download the PDB-style file with coordinates for d1egxa_.
(The format of our PDB-style files is described here.)

Timeline for d1egxa_: