SCOPe 2.08: Domain d1irsa1: 1irs A:157-267

Lineage for d1irsa1 (1irs A:157-267)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)

8. Domain d1irsa1: 1irs A:157-267 [26991]
   Other proteins in same PDB: d1irsa2
   second domain complexed with a IL-4 receptor phosphopeptide

Details for d1irsa1

PDB Entry: 1irs

PDB Description: irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure

PDB Compounds: (A:) irs-1

SCOPe Domain Sequences for d1irsa1:

Sequence; same for both SEQRES and ATOM records:

>d1irsa1 b.55.1.2 (A:157-267) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}
gpafkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcgh
senfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdefrpr

Timeline for d1irsa1:

• d1irsa1 first appeared (with stable ids) in SCOP 1.55, called d1irsa_
  
• d1irsa1 was called d1irsa_ in SCOPe 2.07