Lineage for d1x11b_ (1x11 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132154Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1132155Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1132412Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1132470Protein X11 [50756] (1 species)
  7. 1132471Species Human (Homo sapiens) [TaxId:9606] [50757] (2 PDB entries)
  8. 1132475Domain d1x11b_: 1x11 B: [26986]

Details for d1x11b_

PDB Entry: 1x11 (more details), 2.5 Å

PDB Description: x11 ptb domain
PDB Compounds: (B:) x11

SCOPe Domain Sequences for d1x11b_:

Sequence, based on SEQRES records: (download)

>d1x11b_ b.55.1.2 (B:) X11 {Human (Homo sapiens) [TaxId: 9606]}
iifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevd
lfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqenveashps
qdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp

Sequence, based on observed residues (ATOM records): (download)

>d1x11b_ b.55.1.2 (B:) X11 {Human (Homo sapiens) [TaxId: 9606]}
iifaanylgstqllvrmmqaqeavsrikmaqklaksmtevdlfiltqrikvlnadtqetm
mdhplrtisyiadignivvlmarykmichvfesedaqliaqsigqafsvayqeflrangi
np

SCOPe Domain Coordinates for d1x11b_:

Click to download the PDB-style file with coordinates for d1x11b_.
(The format of our PDB-style files is described here.)

Timeline for d1x11b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x11a_