SCOPe 2.08: Domain d4qc4b1: 4qc4 B:1G-137

Lineage for d4qc4b1 (4qc4 B:1G-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d4qc4b1: 4qc4 B:1G-137 [269803]
   Other proteins in same PDB: d4qc4a2, d4qc4b2
   automated match to d3ojma_
   complexed with flc, imd, na; mutant

Details for d4qc4b1

PDB Entry: 4qc4, 1.49 Å

PDB Description: crystal structure of c117s mutant of human acidic fibroblast growth factor

PDB Compounds: (B:) fibroblast growth factor 1

SCOPe Domain Sequences for d4qc4b1:

Sequence; same for both SEQRES and ATOM records:

>d4qc4b1 b.42.1.1 (B:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsskrg
prthygqkailflplpv

Timeline for d4qc4b1:

• d4qc4b1 first appeared in SCOPe 2.05, called d4qc4b_
  
• d4qc4b1 appears in SCOPe 2.07