Lineage for d4qc4b_ (4qc4 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790653Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1790654Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1790668Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1790730Domain d4qc4b_: 4qc4 B: [269803]
    automated match to d3ojma_
    complexed with flc, imd, na; mutant

Details for d4qc4b_

PDB Entry: 4qc4 (more details), 1.49 Å

PDB Description: crystal structure of c117s mutant of human acidic fibroblast growth factor
PDB Compounds: (B:) fibroblast growth factor 1

SCOPe Domain Sequences for d4qc4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qc4b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
skrgprthygqkailflplpv

SCOPe Domain Coordinates for d4qc4b_:

Click to download the PDB-style file with coordinates for d4qc4b_.
(The format of our PDB-style files is described here.)

Timeline for d4qc4b_:

  • d4qc4b_ appears in periodic updates to SCOPe 2.05 starting on 2015-03-12
  • d4qc4b_ is called d4qc4b1 in SCOPe 2.06
  • d4qc4b_ appears in the current release, SCOPe 2.07, called d4qc4b1