SCOPe 2.08: Domain d4q91a1: 4q91 A:1G-137

Lineage for d4q91a1 (4q91 A:1G-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d4q91a1: 4q91 A:1G-137 [269780]
   Other proteins in same PDB: d4q91a2, d4q91b2
   automated match to d3ojma_
   complexed with fmt, po4; mutant

Details for d4q91a1

PDB Entry: 4q91, 1.8 Å

PDB Description: crystal structure of c16a/k12v/c117v/p134v mutant of human acidic fibroblast growth factor

PDB Compounds: (A:) fibroblast growth factor 1

SCOPe Domain Sequences for d4q91a1:

Sequence; same for both SEQRES and ATOM records:

>d4q91a1 b.42.1.1 (A:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpvllyasngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsvkrg
prthygqkailflvlpv

Timeline for d4q91a1:

• d4q91a1 first appeared in SCOPe 2.05, called d4q91a_
  
• d4q91a1 appears in SCOPe 2.07