| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
| Protein automated matches [190904] (3 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries) |
| Domain d4p24f_: 4p24 F: [269722] automated match to d3anza_ complexed with mpd |
PDB Entry: 4p24 (more details), 3.1 Å
SCOPe Domain Sequences for d4p24f_:
Sequence, based on SEQRES records: (download)
>d4p24f_ f.6.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnag
pydrdswnpvygnqlfmktangsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
>d4p24f_ f.6.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigtvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgtiag
qyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygfngn
vtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnagpyd
rdswnpvygnqlfmktangsmkaaenfldpnkassllssgfspdfatvitmdrkaskqqt
nidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
Timeline for d4p24f_: