Lineage for d4n6la1 (4n6l A:6-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935898Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries)
  8. 2935905Domain d4n6la1: 4n6l A:6-124 [269685]
    Other proteins in same PDB: d4n6la2
    automated match to d1tija_

Details for d4n6la1

PDB Entry: 4n6l (more details), 1.95 Å

PDB Description: crystal structure of human cystatin e/m
PDB Compounds: (A:) cystatin-M

SCOPe Domain Sequences for d4n6la1:

Sequence, based on SEQRES records: (download)

>d4n6la1 d.17.1.0 (A:6-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qermvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyflt
memgstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

Sequence, based on observed residues (ATOM records): (download)

>d4n6la1 d.17.1.0 (A:6-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qermvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyflt
memgstdcrktvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

SCOPe Domain Coordinates for d4n6la1:

Click to download the PDB-style file with coordinates for d4n6la1.
(The format of our PDB-style files is described here.)

Timeline for d4n6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n6la2