Lineage for d1tija_ (1tij A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) 
has a additional strand at the N-terminus
Family d.17.1.2: Cystatins [54407] (7 proteins)
automatically mapped to Pfam PF00031
Protein Cystatin C [64231] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries)
Uniprot P01034 37-146
Domain d1tija_: 1tij A: [119281]
automated match to d1g96a_
Details for d1tija_
PDB Entry: 1tij (more details), 3.03 Å
PDB Description: 3D Domain-swapped human cystatin C with amyloid-like intermolecular beta-sheets
PDB Compounds: (A:) Cystatin CSCOPe Domain Sequences for d1tija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tija_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
prlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldv
elgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
SCOPe Domain Coordinates for d1tija_:
Click to download the PDB-style file with coordinates for d1tija_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tija_:
- d1tija_ first appeared in SCOP 1.73, called d1tija1
- d1tija_ appears in SCOPe 2.07
View in 3D
