SCOPe 2.08: Domain d4mlaa1: 4mla A:29-234

Lineage for d4mlaa1 (4mla A:29-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (13 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225479] (20 PDB entries)

8. Domain d4mlaa1: 4mla A:29-234 [269681]
   Other proteins in same PDB: d4mlaa2, d4mlab2
   automated match to d3s1da1
   complexed with edo, fad, gol, ipa

Details for d4mlaa1

PDB Entry: 4mla, 2.04 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)

PDB Compounds: (A:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4mlaa1:

Sequence; same for both SEQRES and ATOM records:

>d4mlaa1 d.145.1.0 (A:29-234) automated matches {Maize (Zea mays) [TaxId: 4577]}
dmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdiaatvrhvfslgeg
spltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapggelwinvlretlk
hglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtgrgdvvtcspedns
dlfyaalgglgqfgiitrarialepa

Timeline for d4mlaa1:

• d4mlaa1 first appeared in SCOPe 2.05
  
• d4mlaa1 appears in SCOPe 2.07