Lineage for d3s1da1 (3s1d A:33-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987714Species Maize (Zea mays) [TaxId:4577] [225479] (20 PDB entries)
  8. 2987715Domain d3s1da1: 3s1d A:33-245 [216157]
    Other proteins in same PDB: d3s1da2
    automated match to d1w1oa2
    complexed with fad, gol, nag, peg, zir; mutant

Details for d3s1da1

PDB Entry: 3s1d (more details), 1.75 Å

PDB Description: glu381ser mutant of maize cytokinin oxidase/dehydrogenase complexed with n6-isopentenyladenosine
PDB Compounds: (A:) cytokinin dehydrogenase 1

SCOPe Domain Sequences for d3s1da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1da1 d.145.1.0 (A:33-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
pwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanstp
gwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwid
vlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvt
cskqlnadlfdavlgglgqfgvitrariavepa

SCOPe Domain Coordinates for d3s1da1:

Click to download the PDB-style file with coordinates for d3s1da1.
(The format of our PDB-style files is described here.)

Timeline for d3s1da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s1da2