SCOPe 2.08: Domain d4ml8c2: 4ml8 C:235-516

Lineage for d4ml8c2 (4ml8 C:235-516)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.0: automated matches [227166] (1 protein)
   not a true family

6. Protein automated matches [226875] (6 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [269671] (10 PDB entries)

8. Domain d4ml8c2: 4ml8 C:235-516 [269678]
   Other proteins in same PDB: d4ml8a1, d4ml8b1, d4ml8c1, d4ml8d1
   automated match to d2qpma2
   complexed with fad, peg

Details for d4ml8c2

PDB Entry: 4ml8, 2.7 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)

PDB Compounds: (C:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4ml8c2:

Sequence; same for both SEQRES and ATOM records:

>d4ml8c2 d.58.32.0 (C:235-516) automated matches {Maize (Zea mays) [TaxId: 4577]}
pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdpvq
ashfqsdgrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrv
htselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwd
nktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyt
tqeqwkthfgarwetferrkhrydplailapgqrifpkaslp

Timeline for d4ml8c2:

• d4ml8c2 first appeared in SCOPe 2.05
  
• d4ml8c2 appears in SCOPe 2.07