SCOPe 2.08: Domain d4ml8a2: 4ml8 A:235-516

Lineage for d4ml8a2 (4ml8 A:235-516)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
duplication: contains two subdomains of this fold
Family d.58.32.0: automated matches [227166] (1 protein)
not a true family
Protein automated matches [226875] (6 species)
not a true protein
Species Maize (Zea mays) [TaxId:4577] [269671] (10 PDB entries)
Domain d4ml8a2: 4ml8 A:235-516 [269680]
Other proteins in same PDB: d4ml8a1, d4ml8b1, d4ml8c1, d4ml8d1
automated match to d2qpma2
complexed with fad, peg

Details for d4ml8a2

PDB Entry: 4ml8 (more details), 2.7 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)

PDB Compounds: (A:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4ml8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ml8a2 d.58.32.0 (A:235-516) automated matches {Maize (Zea mays) [TaxId: 4577]}
pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdpvq
ashfqsdgrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrv
htselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwd
nktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyt
tqeqwkthfgarwetferrkhrydplailapgqrifpkaslp

SCOPe Domain Coordinates for d4ml8a2:

Click to download the PDB-style file with coordinates for d4ml8a2.
(The format of our PDB-style files is described here.)

Timeline for d4ml8a2: