Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4x6dd_: 4x6d D: [269554] Other proteins in same PDB: d4x6da1, d4x6da2, d4x6dc1, d4x6de1, d4x6de2, d4x6df1, d4x6df2, d4x6dg1, d4x6dg2, d4x6dh1, d4x6dh2 automated match to d1xh3b_ complexed with ola, pam |
PDB Entry: 4x6d (more details), 2.98 Å
SCOPe Domain Sequences for d4x6dd_:
Sequence, based on SEQRES records: (download)
>d4x6dd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwd
>d4x6dd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyllyytey acrvnhvtlsqpkivkwd
Timeline for d4x6dd_: