Lineage for d2jhba_ (2jhb A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550779Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 1550780Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 1550781Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 1550782Protein Core binding factor beta, CBF [50725] (2 species)
  7. 1550791Species Mouse (Mus musculus) [TaxId:10090] [50727] (3 PDB entries)
  8. 1550793Domain d2jhba_: 2jhb A: [26950]

Details for d2jhba_

PDB Entry: 2jhb (more details)

PDB Description: core binding factor beta
PDB Compounds: (A:) protein (core binding factor beta)

SCOPe Domain Sequences for d2jhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhba_ b.54.1.1 (A:) Core binding factor beta, CBF {Mouse (Mus musculus) [TaxId: 10090]}
gsmprvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafv
atgtnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhr
ldgmgclefdeeraqqedalaqq

SCOPe Domain Coordinates for d2jhba_:

Click to download the PDB-style file with coordinates for d2jhba_.
(The format of our PDB-style files is described here.)

Timeline for d2jhba_: